PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019517-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 350aa    MW: 40538.1 Da    PI: 6.6831
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019517-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-092763102155
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            k +yps++e+  LA+++gL+++q+ +WF N+R ++
  SMil_00019517-RA_Salv 276 KWPYPSESEKLALAESTGLDQKQINNWFINQRKRH 310
                            669*****************************885 PP

2ELK36.11.4e-12230251122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELK++Ll+KYsgyL+sLkqE+s
  SMil_00019517-RA_Salv 230 ELKNHLLKKYSGYLSSLKQELS 251
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-2093137IPR005540KNOX1
PfamPF037903.5E-2295136IPR005540KNOX1
SMARTSM012569.2E-28145196IPR005541KNOX2
PfamPF037918.3E-24149195IPR005541KNOX2
PROSITE profilePS5121311.243230250IPR005539ELK domain
SMARTSM011881.0E-6230251IPR005539ELK domain
PfamPF037896.8E-10230251IPR005539ELK domain
PROSITE profilePS5007112.957250313IPR001356Homeobox domain
SuperFamilySSF466891.71E-19251326IPR009057Homeodomain-like
SMARTSM003894.6E-13252317IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-27255316IPR009057Homeodomain-like
CDDcd000861.39E-11262314No hitNo description
PfamPF059201.7E-16270309IPR008422Homeobox KN domain
PROSITE patternPS000270288311IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEEYNHEMSG NSNSRCNFLY GDSSVYGRSS FHLQSPDCYD QSEAQQQQHQ TVKTESRNHA  60
SRFHYTAITP AAVEDHRRRH DRRQENDGSG EAESIKAKII AHPQYSNLLD AYMDCQKVGA  120
PPDVVARLAV VRQEFEASQR AAAAAGRDVS KDPELDQFME AYYDMLVKYR EELTKPIHEA  180
MEFMRRIEKQ LNLLTNNSST DEKYDGGSSE DNSGGEREVP EIDPRAEERE LKNHLLKKYS  240
GYLSSLKQEL SKKKKKGKLP KDARQKLLSW WELHYKWPYP SESEKLALAE STGLDQKQIN  300
NWFINQRKRH WKPSEDMQFM VMDGLHPHNN APPLYMEPHF LGEGPYRLGP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074319.11e-163PREDICTED: homeotic protein knotted-1
SwissprotQ413301e-151KN1_SOLLC; Homeotic protein knotted-1
TrEMBLF6H1591e-161F6H159_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g08380.t011e-161(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-111KNOTTED-like from Arabidopsis thaliana